PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G255200.1.p
Common NameCOL2a, CONSTANS, GLYMA_08G255200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family CO-like
Protein Properties Length: 349aa    MW: 38473.8 Da    PI: 6.3169
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G255200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.41e-061352440
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg...Htvv 40
                         r+C+++ + + + fC+    +lC++C    H +   H++v
  Glyma.08G255200.1.p 13 RMCDTCRSAPSSVFCRAHTAFLCATCDARLHASltwHERV 52
                         68*****************************888888865 PP

2zf-B_box28.72.7e-095297342
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                          ++C+ +e+ ++ + C+ +   lC++C   +H        H +vp+
  Glyma.08G255200.1.p 52 VWVCEACERAPAAFLCKADAASLCASCDADIHAAnplasrHHRVPI 97
                         689*****************************66889999777775 PP

3CCT70.54.2e-24279322144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Glyma.08G255200.1.p 279 REARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT 322
                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.111046IPR000315B-box-type zinc finger
PROSITE profilePS5011910.1821054IPR000315B-box-type zinc finger
CDDcd000211.67E-61354No hitNo description
SMARTSM003361.5E-135097IPR000315B-box-type zinc finger
PROSITE profilePS5011910.9645097IPR000315B-box-type zinc finger
PfamPF006435.7E-75197IPR000315B-box-type zinc finger
CDDcd000216.17E-85397No hitNo description
PROSITE profilePS5101716.648279321IPR010402CCT domain
PfamPF062036.5E-18279321IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MLDGEATMGT WARMCDTCRS APSSVFCRAH TAFLCATCDA RLHASLTWHE RVWVCEACER  60
APAAFLCKAD AASLCASCDA DIHAANPLAS RHHRVPILPI AAAPGNNDND NVDDADLDDD  120
DETASWLLLN PVKSASVPNN NNTNNGFSYN GEVDEYLDLV DDCDNHHFAS VATTTDHYSH  180
QHQHFGVVSH KSYAGDSVVP VQHHQHFQLG LEFDNSKAAF SYNASVNQSV SVSSMDIGVV  240
PESPMRDVSI GHTRTPKGTI DLFSGPPIQV PSHFSPMDRE ARVLRYREKK KTRKFEKTIR  300
YASRKAYAET RPRIKGRFAK RTDVEAEVDQ MFSTTLITEV GYGIVPSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.253740.0leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3712430.0DQ371243.1 Glycine max CONSTANS-like 2a (COL2a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235828.10.0CONSTANS-like 2a
SwissprotQ965021e-126COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLB9MSS50.0B9MSS5_SOYBN; CONSTANS protein
STRINGGLYMA08G28370.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38273352
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.12e-89CONSTANS-like 2